FAM125A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18422702	Novus Biologicals NBP1-91883-25ul	25 μL

Description

FAM125A Polyclonal specifically detects FAM125A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: FAM125A
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 93343
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:ISCTVEGAPASFGKSFAQKSGYFLCLSSLGSLENPQENVVADIQIVVDKSPLPLGFSPVCDPMDSKASVSKKKRMCVKLLPL
• Primary or Secondary: Primary
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: CFBP, CIN85/CD2AP family binding protein, CIN85/CD2AP family-binding protein, ESCRT-I complex subunit MVB12A, family with sequence similarity 125, member A, FLJ32495, multivesicular body subunit 12A, Protein FAM125A
• Gene Symbols: MVB12A
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only