missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. FAM123C Antibody, R&D Systems™

FAM123C Antibody, R&D Systems™

Product Code. 18602906 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity Unit Size
18602906 25 μL 25µL
18118568 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 missing translation for 'options'
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit. 18602906 missing translation for 'mfr' Novus Biologicals missing translation for 'supplierNo' NBP23871925ul
  • ONLINE EXCLUSIVE PRICE
    £365.01
    £309.75 / 25µL
    Save £55.26
    15% Off
 Restricted Item
Estimated Shipment: 02-12-2026
Ajouter au panier
Ajouter au panier

missing translation for 'validMainframeMsg'

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

FAM123C Polyclonal specifically detects FAM123C in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Spécification

Antigen FAM123C
Applications Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q8N944
Gene Alias family with sequence similarity 123C
Gene Symbols AMER3
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: SDFTRFWDSVNRSVRQQQRALLGPWLSGPQGTDRDQPRLDTAGLAELPLCPCRDPRSGSKASSIDTGTPKSEQPESVSTS
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 205147
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Product Type Antibody
Isotype IgG
Product Line Novus
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.