missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FAM118A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | FAM118A |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
FAM118A Polyclonal specifically detects FAM118A in Human samples. It is validated for Western Blot.Specifications
| FAM118A | |
| Polyclonal | |
| Rabbit | |
| Q9NWS6 | |
| 55007 | |
| Synthetic peptides corresponding to FAM118A (family with sequence similarity 118, member A) The peptide sequence was selected from the middle region of FAM118A. Peptide sequence EVMEVLQNLYRTKSFLFVGCGETLRDQIFQALFLYSVPNKVDLEHYMLVL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| bK268H5.C22.4, C22orf8, chromosome 22 open reading frame 8, family with sequence similarity 118, member A, FLJ20635, hypothetical protein LOC55007 | |
| FAM118A | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title