missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FAM105A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | FAM105A |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
FAM105A Polyclonal specifically detects FAM105A in Human samples. It is validated for Western Blot.Specifications
| FAM105A | |
| Polyclonal | |
| Rabbit | |
| Q9NUU6 | |
| 54491 | |
| Synthetic peptides corresponding to FAM105A (family with sequence similarity 105, member A) The peptide sequence was selected from the N terminal of FAM105A. Peptide sequence HKLKWWIGYLQRKFKRNLSVEAEVDLLSYCAREWKGETPRNKLMRKAYEE. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| family with sequence similarity 105, member A, FLJ11127, FLJ43660, hypothetical protein LOC54491, NET20 | |
| FAM105A | |
| IgG | |
| 42 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title