missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FAIM2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-33537
This item is not returnable.
View return policy
Description
FAIM2 Polyclonal specifically detects FAIM2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| FAIM2 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Q9BWQ8 | |
| FAIM2 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PTAVPLHPSWAYVDPSSSSSYDNGFPTGDHELFTTFSWDDQKVRRVFVRKV | |
| 0.1 mL | |
| Apoptosis | |
| 23017 | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Fas apoptotic inhibitory molecule 2, KIAA0950NGP35, LFG2, LFGLIFEGUARD, NMP35neural membrane protein 35, Protein lifeguard, TMBIM2lifeguard, transmembrane BAX inhibitor motif containing 2, Transmembrane BAX inhibitor motif-containing protein 2 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction