missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FAHD2A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | FAHD2A |
|---|---|
| Applications | Western Blot, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18137389
|
Novus Biologicals
NBP2-54717 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18607787
|
Novus Biologicals
NBP2-54717-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
FAHD2A Polyclonal specifically detects FAHD2A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| FAHD2A | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 51011 | |
| This antibody was developed against a Recombinant Protein corresponding to amino acids:KWPFQPSRDMRLVQFRAPHLVGPHLGLETGNGGGVINLNAFDPTLPKTMTQFLEQGEATLSVARRALAAQLPVLP | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| CGI-105, EC 3.-, fumarylacetoacetate hydrolase domain containing 1, fumarylacetoacetate hydrolase domain containing 2A, fumarylacetoacetate hydrolase domain-containing protein 2A, MGC131995 | |
| FAHD2A | |
| IgG | |
| Immunogen affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title