FAHD2A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-54694-25ul

Product Code. 18654149

Description

FAHD2A Polyclonal specifically detects FAHD2A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: FAHD2A
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunohistochemistry-Paraffin 1:5000 - 1:10000
• Gene Alias: CGI-105, EC 3.-, fumarylacetoacetate hydrolase domain containing 1, fumarylacetoacetate hydrolase domain containing 2A, fumarylacetoacetate hydrolase domain-containing protein 2A, MGC131995
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Western Blot, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: FAHD2A
• Immunogen: This antibody was developed against a Recombinant Protein corresponding to amino acids:NYVDHCKEQNVPVPKEPIIFSKFASSIVGPYDEVVLPPQSQEVDWEVELAVVIGKKGKHIKATDAMAHVAGFTVAHDVSARDW
• Quantity: 25 μL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 51011
• Target Species: Human
• Isotype: IgG