missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FAHD2A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-54694
This item is not returnable.
View return policy
Description
FAHD2A Polyclonal specifically detects FAHD2A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| FAHD2A | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry-Paraffin 1:5000 - 1:10000 | |
| CGI-105, EC 3.-, fumarylacetoacetate hydrolase domain containing 1, fumarylacetoacetate hydrolase domain containing 2A, fumarylacetoacetate hydrolase domain-containing protein 2A, MGC131995 | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| FAHD2A | |
| This antibody was developed against a Recombinant Protein corresponding to amino acids:NYVDHCKEQNVPVPKEPIIFSKFASSIVGPYDEVVLPPQSQEVDWEVELAVVIGKKGKHIKATDAMAHVAGFTVAHDVSARDW | |
| 100 μL | |
| Lipid and Metabolism | |
| 51011 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction