missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EZFIT/ZNF71 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | EZFIT/ZNF71 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
EZFIT/ZNF71 Polyclonal specifically detects EZFIT/ZNF71 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| EZFIT/ZNF71 | |
| Polyclonal | |
| Rabbit | |
| NP_067039 | |
| 58491 | |
| Synthetic peptide directed towards the middle region of human ZNF71. Peptide sequence RCGQCGKSFIKNSSLTVHQRIHTGEKPYRCGECGKTFSRNTNLTRHLRIH. | |
| Primary |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| endothelial zinc finger protein induced by tumor necrosis factor alpha, Kruppel-related zinc finger protein, zinc finger protein 71 (Cos26), zinc finger protein 71EZFITCos26 | |
| ZNF71 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title