missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Exportin-T Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | Exportin-T |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
Description
Exportin-T Polyclonal specifically detects Exportin-T in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin.Specifications
| Exportin-T | |
| Unconjugated | |
| RUO | |
| exportin(tRNA), exportin, tRNA (nuclear export receptor for tRNAs), exportin-T, tRNA exportin, XPO3 | |
| XPOT | |
| IgG |
| Polyclonal | |
| Rabbit | |
| O43592 | |
| 11260 | |
| Synthetic peptides corresponding to XPOT(exportin, tRNA (nuclear export receptor for tRNAs)) The peptide sequence was selected from the middle region of XPOT. Peptide sequence TVLSDQQKANVEAIMLAVMKKLTYDEEYNFENEGEDEAMFVEYRKQLKLL. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title