Exostosin-like 1/EXTL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18487621	Novus Biologicals NBP1-90470-25ul	25 μL
18243547	Novus Biologicals NBP1-90470	0.1 mL

Description

Exostosin-like 1/EXTL1 Polyclonal specifically detects Exostosin-like 1/EXTL1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Exostosin-like 1/EXTL1
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 2134
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:ALPPRPRPGASQGWPRWLDAELLQSFSQPGELPEDAVSPPQAPHGGSCNWESCFDTSKCRGDGLKVFVYPAVGTISETHRRILASIEGS
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: alpha-N-acetylglucosaminyltransferase II, EC 2.4.1.224, exostoses (multiple)-like 1, exostosin-L, EXTLexostosin-like 1, glucuronosyl-N-acetylglucosaminyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase, Glucuronosyl-N-acetylglucosaminyl-proteoglycan4-alpha-N-acetylglucosaminyltransferase, glucuronyl-N-acetylglucosaminylproteoglycan alpha-1,4-N-acetylglucosaminyltransferase, MGC70794, Multiple exostosis-like protein
• Gene Symbols: EXTL1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only