missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Exosome Component 9 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £513.00
Specifications
| Antigen | Exosome Component 9 |
|---|---|
| Dilution | Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18204194
|
Novus Biologicals
NBP2-57565 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18601057
|
Novus Biologicals
NBP2-57565-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Exosome Component 9 Polyclonal specifically detects Exosome Component 9 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Exosome Component 9 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Autoantigen PM/Scl 1, EC 3.1.13, exosome component 9Polymyositis/scleroderma autoantigen 75 kDa, p6, PM/Scl-75P75 polymyositis-scleroderma overlap syndrome-associated autoantigen, PMSCL175kD, Polymyositis/scleroderma autoantigen 1, polymyositis/scleroderma autoantigen 1 (75kD), polymyositis/scleroderma autoantigen 1, 75kDa | |
| EXOSC9 | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 5393 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PNEREERVMDGLLVIAMNKHREICTIQSSGGIMLLKDQVLRCSKIAGVKVAEITELILKALENDQKVRKEGGKFGFAESIANQRITA | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title