missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Exosome Component 9 Antibody, Novus Biologicals™

Exosome Component 9 Antibody, Novus Biologicals™

Product Code. 18413861 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18413861 0.1 mL 0.10mL
18474661 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18413861 Supplier Novus Biologicals Supplier No. NBP187369

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Exosome Component 9 Polyclonal antibody specifically detects Exosome Component 9 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Exosome Component 9
Applications Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:20 - 1:50
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias Autoantigen PM/Scl 1, EC 3.1.13, exosome component 9Polymyositis/scleroderma autoantigen 75 kDa, p6, PM/Scl-75P75 polymyositis-scleroderma overlap syndrome-associated autoantigen, PMSCL175kD, Polymyositis/scleroderma autoantigen 1, polymyositis/scleroderma autoantigen 1 (75kD), polymyositis/scleroderma autoantigen 1, 75kDa
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: CVVAGEKVWQIRVDLHLLNHDGNIIDAASIAAIVALCHFRRPDVSVQGDEVTLYTPEERDPVPLSIHHMPICVSFA
Purification Method Immunogen affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 5393
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.