Exosome component 8 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Bio-Techne NBP3-17842-25UL

Product Code. 18397871

Description

Exosome component 8 Polyclonal antibody specifically detects Exosome component 8 in Human samples. It is validated for Immunofluorescence

Specifications

• Antigen: Exosome component 8
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
• Gene Alias: bA421P11.3, CBP-interacting protein 3, CIP3, EAP2, exosome complex exonuclease RRP43, exosome component 8Opa-interacting protein 2, OIP2Ribosomal RNA-processing protein 43, Opa interacting protein 2, p9RP11-421P11.3, RRP43OIP-2, Rrp43p
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SGPPGEEAQVASQFIADVIENSQIIQKEDLCISPGKLVWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEETA
• Quantity: 25 μg
• Research Discipline: DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 11340
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified