missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Exosome component 4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£378.00
Specifications
| Antigen | Exosome component 4 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
Exosome component 4 Polyclonal specifically detects Exosome component 4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Exosome component 4 | |
| Polyclonal | |
| Purified | |
| RUO | |
| exosome complex exonuclease RRP41, exosome component 4Rrp41p, exosome component Rrp41, FLJ20591, p12ARibosomal RNA-processing protein 41, RRP41A, RRP41Ski6p, SKI6hRrp41p | |
| EXOSC4 | |
| IgG | |
| Protein A purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Q9NPD3 | |
| 54512 | |
| Synthetic peptides corresponding to EXOSC4 (exosome component 4) The peptide sequence was selected from the N terminal of Exosome component 4 . Peptide sequence SDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHE. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title