missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EXOC6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | EXOC6 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
EXOC6 Polyclonal specifically detects EXOC6 in Human, Mouse samples. It is validated for Western Blot.Specifications
| EXOC6 | |
| Polyclonal | |
| Rabbit | |
| B3KXY5 | |
| 54536 | |
| Synthetic peptides corresponding to EXOC6(exocyst complex component 6) Antibody(against the N terminal of EXOC6. Peptide sequence MLEEETDQTYENVLAEIQSFELPVEATLRSVYDDQPNAHKKFMEKLDACI. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DKFZp761I2124, EXOC6A, exocyst complex component 6, Exocyst complex component Sec15A, FLJ1125, FLJ11251, MGC33397, SEC15A, SEC15L1SEC15-like 1 (S. cerevisiae), SEC15L3, SEC15-like 1, SEC15-like protein 1, SEC15-like protein 3, SEC15LSEC15, Sec15p | |
| EXOC6 | |
| IgG | |
| 88 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title