missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ EVI2A Antibody, Novus Biologicals™

Product Code. 18344168 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.05 mg
Unit Size:
0.05mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18344168 0.05 mg 0.05mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18344168 Supplier Novus Biologicals™ Supplier No. H00002123B01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Polyclonal Antibody

EVI2A Polyclonal antibody specifically detects EVI2A in Human samples. It is validated for Flow Cytometry,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen EVI2A
Applications Flow Cytometry, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500, Flow Cytometry
Formulation PBS (pH 7.4)
Gene Accession No. AAH35572
Gene Alias ecotropic viral integration site 2A, EVDAEVI2Ecotropic viral integration site 2A protein homolog, EVI-2A, protein EVI2A
Host Species Mouse
Immunogen EVI2A (AAH35572, 25 a.a. - 236 a.a.) full-length human protein. SPGTKANYTRLWANSTSSWDSVIQNKTGRNQNENINTNPITPEVDYKGNSTNMPETSHIVALTSKSEQELYIPSVVSNSPSTVQSIENTSKSHGEIFKKDVCAENNNNMAMLICLIIIAVLFLICTFLFLSTVVLANKVSSLRRSKQVGKRQPRSNGDFLASGLWPAESDTWKRTKQLTGPNLVMQSTGVLTATRERKDEEGTEKLTNKQIG
Purification Method Protein A purified
Quantity 0.05 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2123
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze/thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.