missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18362128

EVI-1 Antibody (1E7), Novus Biologicals™

Product Code. 18362128 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18362128 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18362128 Supplier Novus Biologicals Supplier No. H00004197M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

EVI-1 Monoclonal antibody specifically detects EVI-1 in Human samples. It is validated for Western Blot, ELISA, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen EVI-1
Applications Western Blot, ELISA, Sandwich ELISA
Classification Monoclonal
Clone 1E7
Conjugate Unconjugated
Dilution Western Blot 1:500
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_004982
Gene Alias AML1-EVI-1, AML1-EVI-1 fusion protein, ecotropic viral integration site 1, Ecotropic virus integration site 1 protein homolog, EVI-1, EVI1MDS1-EVI1, MDS1, MDS1 and EVI1 complex locus, MDS1 and EVI1 complex locus protein EVI1, MDS1 and EVI1 complex locus protein MDS1, MGC163392, MGC97004, myelodysplasia syndrome 1, Myelodysplasia syndrome 1 protein, Myelodysplasia syndrome-associated protein 1, oncogene EVI1, PRDM3, zinc finger protein Evi1
Host Species Mouse
Immunogen MDS1 (NP_004982, 80 a.a. ~ 169 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FELRESNMPGAGLGIWTKRKIEVGEKFGPYVGEQRSNLKDPSYGWEVHLPRSRRVSVHSWLYLGKRSSDVGIAFSQADVYMPGLQCAFLS
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline DNA replication Transcription Translation and Splicing
Primary or Secondary Primary
Gene ID (Entrez) 2122
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.