missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Eukaryotic translation initiation factor 5B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-85120
This item is not returnable.
View return policy
Description
Eukaryotic translation initiation factor 5B Polyclonal specifically detects Eukaryotic translation initiation factor 5B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| Eukaryotic translation initiation factor 5B | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| DKFZp434I036, eukaryotic translation initiation factor 5B, FLJ10524, IF2Translation initiation factor IF-2, KIAA0741eIF-5B, translation initiation factor IF2 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 9669 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| EIF5B | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:QEMADSLGVRIFSAEIIYHLFDAFTKYRQDYKKQKQEEFKHIAVFPCKIKILPQYIFNSRDPIVMGVTVEAGQVKQGTPMCVPSK | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur