missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
ETV3 Polyclonal antibody specifically detects ETV3 in Human samples. It is validated for Western Blot
Specifications
Specifications
| Antigen | ETV3 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 0.04-0.4 ug/ml |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | bA110J1.4, ETS domain transcriptional repressor PE1, ETS translocation variant 3, ets variant 3, ets variant gene 3, ETS family transcriptional repressor, METS, Mitogenic Ets transcriptional suppressor, PE-1ets variant gene 3, PE1FLJ79173 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SSRFHFPPLDTHSPTNDVQPGRFSASSLTASGQESSNGTDRKTELSELEDGSAADWRRGVDPVSSRNAIGGGGIGHQKR |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?