missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ETS2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35702-100ul
This item is not returnable.
View return policy
Description
ETS2 Polyclonal antibody specifically detects ETS2 in Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| ETS2 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| ETS2IT1, human erythroblastosis virus oncogene homolog 210protein C-ets-2, oncogene ETS-2, v-ets avian erythroblastosis virus E2 oncogene homolog 2, v-ets avian erythroblastosis virus E26 oncogene homolog 2, v-ets erythroblastosis virus E26 oncogene homolog 2 (avian) | |
| A synthetic peptide corresponding to a sequence within amino acids 300-400 of human ETS2 (NP_005230.1).,, Sequence:, SSLLDVQRVPSFESFEDDCSQSLCLNKPTMSFKDYIQERSDPVEQGKPVIPAAVLAGFTGSGPIQLWQFLLELLSDKSCQSFISWTGDGWEFKLADPDEVA | |
| 100 μL | |
| Stem Cell Markers | |
| 2114 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction