missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ETEA Antibody, Novus Biologicals™

ETEA Antibody, Novus Biologicals™

Product Code. p-200083023 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μL
25 μL
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18286724 100 μL 100µL
18623658 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18286724 Supplier Novus Biologicals Supplier No. NBP257425

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

ETEA Polyclonal specifically detects ETEA in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Specifications

Antigen ETEA
Applications Western Blot, Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias B17.2L, ETEAFAS-associated factor 2, expressed in T-cells and eosinophils in atopic dermatitis, Fas associated factor family member 2, KIAA0887UBX domain protein 3B, MMTN, NDUNDUFA12L, UBX domain containing 8, UBX domain-containing protein 3B, UBX domain-containing protein 8, UBXD8, UBXN3BProtein ETEA
Gene Symbols FAF2
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PEPSPDDPESVKIIFKLPNDSRVERRFHFSQSLTVIHDFLFSLKESPEKFQIEANFPRRVLPCIPSEEWPNPPTLQEAGLSHTEV
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 23197
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.