ETEA Antibody, Novus Biologicals™

Product Code.	Quantity	unitSize
18286724	100 μL	100µL
18623658	25 μL	25µL

Product Code. 18286724 Supplier Novus Biologicals Supplier No. NBP257425

Description

Rabbit Polyclonal Antibody

ETEA Polyclonal specifically detects ETEA in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: ETEA
• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Classification: Polyclonal
• Conjugate: Unconjugated
• Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Alias: B17.2L, ETEAFAS-associated factor 2, expressed in T-cells and eosinophils in atopic dermatitis, Fas associated factor family member 2, KIAA0887UBX domain protein 3B, MMTN, NDUNDUFA12L, UBX domain containing 8, UBX domain-containing protein 3B, UBX domain-containing protein 8, UBXD8, UBXN3BProtein ETEA
• Gene Symbols: FAF2
• Host Species: Rabbit
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PEPSPDDPESVKIIFKLPNDSRVERRFHFSQSLTVIHDFLFSLKESPEKFQIEANFPRRVLPCIPSEEWPNPPTLQEAGLSHTEV
• Purification Method: Affinity Purified
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 23197
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Target Species: Human
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only