missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ESD Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ESD |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
Description
ESD Polyclonal specifically detects ESD in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| ESD | |
| Unconjugated | |
| RUO | |
| EC 3.1.2.12, esterase 10, esterase Desterase D/formylglutathione hydrolase, FGH, FLJ11763, S-formylglutathione hydrolase | |
| ESD | |
| IgG |
| Polyclonal | |
| Rabbit | |
| P10768 | |
| 2098 | |
| Synthetic peptides corresponding to ESD(esterase D/formylglutathione hydrolase) The peptide sequence was selected from the N terminal of ESD. Peptide sequence MALKQISSNKCFGGLQKVFEHDSVELNCKMKFAVYLPPKAETGKCPALYW. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title