missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ERRFI1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£231.00 - £571.00
Specifications
| Antigen | ERRFI1 |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/mL, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL |
| Applications | Western Blot, Immunocytochemistry |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18499890
|
Novus Biologicals
NBP1-81835-25ul |
25 μL |
£231.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18417200
|
Novus Biologicals
NBP1-81835 |
0.1 mL |
£571.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ERRFI1 Polyclonal antibody specifically detects ERRFI1 in Human samples. It is validated for Western Blot, Immunocytochemistry/ ImmunofluorescenceSpecifications
| ERRFI1 | |
| Western Blot, Immunocytochemistry | |
| Unconjugated | |
| Rabbit | |
| Cancer, Cardiovascular Biology, Endocrinology, Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol | |
| 54206 | |
| IgG | |
| Immunogen affinity purified |
| Western Blot 0.04-0.4 ug/mL, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| ERBB receptor feedback inhibitor 1, GENE-33, MIG6, MIG-6Mitogen-inducible gene 6 protein, RALTreceptor-associated late transducer | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:NGGVPDPNPPPPQTHRRLRRSHSGPAGSFNKPAIRISNCCIHRASPNSDEDKPEVPPRVPIPPRPVKPDYRRWSAEVTSSTY | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title