missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ERR gamma/NR3B3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-91873-25ul
This item is not returnable.
View return policy
Description
ERR gamma/NR3B3 Polyclonal antibody specifically detects ERR gamma/NR3B3 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| ERR gamma/NR3B3 | |
| Polyclonal | |
| Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| DKFZp781L1617, ERR gamma-2, ERR3, ERRG2, ERRgamma, Estrogen receptor-related protein 3, estrogen-related receptor gamma, FLJ16023, KIAA0832, NR3B3, Nuclear receptor subfamily 3 group B member 3 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: SGSYSSTMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYMLNSMPK | |
| 25 μL | |
| Cancer, Endocrinology, Signal Transduction | |
| 2104 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction