ERR gamma/NR3B3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-91873

Product Code. 18490532

Description

ERR gamma/NR3B3 Polyclonal antibody specifically detects ERR gamma/NR3B3 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

• Antigen: ERR gamma/NR3B3
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: DKFZp781L1617, ERR gamma-2, ERR3, ERRG2, ERRgamma, Estrogen receptor-related protein 3, estrogen-related receptor gamma, FLJ16023, KIAA0832, NR3B3, Nuclear receptor subfamily 3 group B member 3
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SGSYSSTMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYMLNSMPK
• Quantity: 0.1 mL
• Research Discipline: Cancer, Endocrinology, Signal Transduction
• Gene ID (Entrez): 2104
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified