missing translation for 'onlineSavingsMsg'
Learn More

ERp57/PDIA3 Antibody (CL2444), Novus Biologicals™

Product Code. 18663326 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18663326 25 μL 25µL
18090936 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18663326 Supplier Novus Biologicals Supplier No. NBP23676525ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody has been used in 1 publication

ERp57/PDIA3 Monoclonal specifically detects ERp57/PDIA3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.
TRUSTED_SUSTAINABILITY

Specifications

Antigen ERp57/PDIA3
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone CL2444
Conjugate Unconjugated
Dilution Western Blot 1 μg/mL, Immunohistochemistry 1:5000 - 1:10000, Immunocytochemistry/Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:5000 - 1:10000, Knockdown Validated
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. G5EA52
Gene Alias Disulfide isomerase ER-60, EC 5.3.4.1, endoplasmic reticulum P58, Endoplasmic reticulum resident protein 57, Endoplasmic reticulum resident protein 60, ER protein 60, ER60, ERP57, ERp5758 kDa glucose-regulated protein, ERP60, ERp6058 kDa microsomal protein, ERp61, glucose regulated protein, 58kDa, GRP57, GRP58ER protein 57, HsT17083, P58, phospholipase C-alpha, PI-PLC, protein disulfide isomerase family A, member 3, protein disulfide isomerase-associated 3, protein disulfide-isomerase A3
Gene Symbols PDIA3
Host Species Mouse
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNGEGIILFRPSHLTNKFEDK
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cellular Markers, ER Markers, Membrane Trafficking and Chaperones
Primary or Secondary Primary
Gene ID (Entrez) 2923
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reconstitution Protein A purified
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Form Purified
Isotype IgG1
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.