missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
ERN2 Polyclonal antibody specifically detects ERN2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | ERN2 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | EC 2.7.11, endoplasmic reticulum to nucleus signaling 2, endoplasmic reticulum to nucleus signalling 2, Endoplasmic reticulum-to-nucleus signaling 2, ER to nucleus signalling 2, hIRE2p, inositol-requiring 1 beta, Inositol-requiring protein 2, IRE1, S. cerevisiae, homolog of, Ire1-beta, IRE1bIRE1 beta, IRE2, serine/threonine-protein kinase/endoribonuclease IRE2 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HHELPPVLHTTMLRVHPTLGSGTAETRPPENTQAPAFFLELLSLSREKLWDSELHPEEKTPDSYLGLGPQD |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?