ERCC8 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18317084	Novus Biologicals NBP3-10927-25UL	25 μg
18366374	Novus Biologicals NBP3-10927-100UL	100 μg

Description

ERCC8 Polyclonal specifically detects ERCC8 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ERCC8
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Host Species: Rabbit
• Research Discipline: Cancer, DNA Repair, Nucleotide Excision Repair
• Formulation: PBS buffer, 2% sucrose
• Gene ID (Entrez): 1161
• Primary or Secondary: Primary
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
• Classification: Polyclonal
• Form: Purified
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: CKN1DNA excision repair protein ERCC-8, Cockayne syndrome 1 (classical), Cockayne syndrome WD repeat protein CSA, CSACockayne syndrome WD-repeat protein CSA, excision repair cross-complementing rodent repair deficiency, complementationgroup 8
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ERCC8 (NP_000073). Peptide sequence DVERIHGGGINTLDIEPVEGRYMLSGGSDGVIVLYDLENSSRQSYYTCKA
• Purification Method: Affinity purified