missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ERCC8 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-10927-100UL
This item is not returnable.
View return policy
Description
ERCC8 Polyclonal specifically detects ERCC8 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| ERCC8 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin | |
| CKN1DNA excision repair protein ERCC-8, Cockayne syndrome 1 (classical), Cockayne syndrome WD repeat protein CSA, CSACockayne syndrome WD-repeat protein CSA, excision repair cross-complementing rodent repair deficiency, complementationgroup 8 | |
| The immunogen is a synthetic peptide directed towards the N terminal region of human ERCC8 (NP_000073). Peptide sequence DVERIHGGGINTLDIEPVEGRYMLSGGSDGVIVLYDLENSSRQSYYTCKA | |
| 100 μg | |
| Cancer, DNA Repair, Nucleotide Excision Repair | |
| 1161 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction