missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ERCC6L Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ERCC6L |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ERCC6L Polyclonal specifically detects ERCC6L in Human samples. It is validated for Western Blot.Specifications
| ERCC6L | |
| Polyclonal | |
| Rabbit | |
| Core ESC Like Genes, Stem Cell Markers | |
| ATP-dependent helicase ERCC6-like, DNA excision repair protein ERCC-6-like, EC 3.6.1, EC 3.6.4.12, excision repair cross-complementing rodent repair deficiency, complementationgroup 6-like, excision repair protein ERCC6-like, FLJ20105, MGC131695, PICHexcision repair cross-complementing rodent repair deficiency complementationgroup 6 - like, PLK1-interacting checkpoint helicase, SNF2/RAD54 family protein, Tumor antigen BJ-HCC-15 | |
| ERCC6L | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q2NKX8 | |
| 54821 | |
| Synthetic peptides corresponding to ERCC6L Antibody(against the N terminal of ERCC6L. Peptide sequence GDLEEAFKLFNLAKDIFPNEKVLSRIQKIQEALEELAEQGDDEFTDVCNS. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title