missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ Epsin-2 Recombinant Protein Antigen
Shop All Bio Techne Products
Click to view available options
Quantity:
100 μL
missing translation for 'unitSize'
100µL
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Epsin-2. Source: E.coli Amino Acid Sequence: PLGQSEELQPLSQRHPFLPHLGLASRPNGDWSQPCLTCDRAARATSPRVSSEL The Epsin-2 Recombinant Protein Antigen is derived from E. coli. The Epsin-2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Spécification
Spécification
| Gene ID (Entrez) | 22905 |
| Purification Method | >80% by SDS-PAGE and Coomassie blue staining |
| Common Name | Epsin-2 Recombinant Protein Antigen |
| Content And Storage | Store at −20°C. Avoid freeze-thaw cycles. |
| Formulation | PBS and 1M Urea, pH 7.4. |
| For Use With (Application) | Blocking/Neutralizing, Control |
| Gene Alias | Eps15 binding protein, EPS-15-interacting protein 2, epsin 2, epsin-2, KIAA1065EHB21 |
| Gene Symbol | EPN2 |
| Label Type | Unlabeled |
| Product Type | Recombinant Protein Antigen |
| Afficher plus |
For Research Use Only.
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu