Epithelial Stromal Interaction 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-69247

Product Code. 18245551

Description

Epithelial Stromal Interaction 1 Polyclonal specifically detects Epithelial Stromal Interaction 1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Epithelial Stromal Interaction 1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: BRESI1, EC 3.1.4.16, EC 3.6.3.6, epithelial stromal interaction 1 (breast), epithelial-stromal interaction protein 1, MGC29634
• Host Species: Rabbit
• Molecular Weight of Antigen: 47 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Canine: 86%; Bovine: 86%; .
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96J88
• Gene Symbols: EPSTI1
• Immunogen: Synthetic peptides corresponding to EPSTI1(epithelial stromal interaction 1 (breast)) The peptide sequence was selected from the N terminal of Epithelial Stromal Interaction 1. Peptide sequence RRLGGSQSETEVRQKQQLQLMQSKYKQKLKREESVRIKKEAEEAELQKMK.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 94240
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only