missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
epithelial Sodium Channel alpha Polyclonal antibody specifically detects epithelial Sodium Channel alpha in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | epithelial Sodium Channel alpha |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Formulation | PBS (pH 7.2) and 40% Glycerol |
| Gene Alias | alpha ENaC-2, alpha-ENaC, Alpha-NaCH, amiloride-sensitive epithelial sodium channel alpha subunit, amiloride-sensitive sodium channel subunit alpha, amiloride-sensitive sodium channel subunit alpha 2, BESC2, ENaCA, ENaCalpha, Epithelial Na(+) channel subunit alpha, FLJ21883, nasal epithelial sodium channel alpha subunit, Nonvoltage-gated sodium channel 1 subunit alpha, SCNEA, SCNN1, sodium channel, nonvoltage-gated 1 alpha |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RYPEIKEELEELDRITEQTLFDLYKYSSFTTLVAGSRSRRDLRGTLPHPLQRLRVPPPPHGARRARSVASSLRDNNPQVDWKDWKIGFQL |
| Purification Method | Immunogen affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?