missing translation for 'onlineSavingsMsg'
Learn More

Epiregulin Antibody (1E6), Novus Biologicals™

Product Code. 18396667 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18396667 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18396667 Supplier Novus Biologicals Supplier No. H00002069M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

Epiregulin Monoclonal antibody specifically detects Epiregulin in Human samples. It is validated for ELISA, Immunocytochemistry/ Immunofluorescence, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen Epiregulin
Applications ELISA, Immunocytochemistry, Sandwich ELISA
Classification Monoclonal
Clone 1E6
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_001423
Gene Alias epiregulin, ER, proepiregulin
Host Species Mouse
Immunogen EREG (NP_001423, 32 a.a. ~ 117 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. STTVIPSCIPGESSDNCTALVQTEDNPRVAQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFLTVHQPLSKE
Purification Method Protein A purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Angiogenesis
Primary or Secondary Primary
Gene ID (Entrez) 2069
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.