Novus Biologicals™ Epimorphin/Syntaxin 2 Recombinant Protein Antigen

Product Code. 18259803

Brand: Novus Biologicals™ NBP255283PEP

Descripción

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Epimorphin/Syntaxin 2. Source: E.coli Amino Acid Sequence: DRLPDLTACRKNDDGDTVVVVEKDHFMDDFFHQVEEIRNTIDKITQYVEEVKK The Epimorphin/Syntaxin 2 Recombinant Protein Antigen is derived from E. coli. The Epimorphin/Syntaxin 2 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Especificaciones

• Gene ID (Entrez): 2054
• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Common Name: Epimorphin/Syntaxin 2 Recombinant Protein Antigen
• Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
• Formulation: PBS and 1M Urea, pH 7.4
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Alias: EPIMepimorphin, EPM, STX2AMGC51014, STX2Bsyntaxin-2, STX2CEpimorphin, syntaxin 2
• Gene Symbol: STX2
• Label Type: Unlabeled
• Product Type: Recombinant Protein Antigen
• Quantity: 100 μL
• Regulatory Status: RUO
• Research Category: Neuroscience
• Source: E.coli
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51323. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

For research use only.