missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EPB4IL2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | EPB4IL2 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
EPB4IL2 Polyclonal specifically detects EPB4IL2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| EPB4IL2 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| band 4.1-like protein 2,4.1G, DKFZp781D1972, DKFZp781H1755,4.1-G, erythrocyte membrane protein band 4.1 like-protein 2, erythrocyte membrane protein band 4.1-like 2, Generally expressed protein 4.1 | |
| EPB41L2 | |
| IgG |
| Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
| Polyclonal | |
| Rabbit | |
| O43491 | |
| 2037 | |
| Synthetic peptides corresponding to EPB41L2(erythrocyte membrane protein band 4.1-like 2) The peptide sequence was selected from the middle region of EPB41L2. Peptide sequence AKRLWKVCVEHHTFYRLVSPEQPPKAKFLTLGSKFRYSGRTQAQTRQAST. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title