missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EPB42 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | EPB42 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
EPB42 Polyclonal specifically detects EPB42 in Human samples. It is validated for Western Blot.Specifications
| EPB42 | |
| Polyclonal | |
| Rabbit | |
| P16452-2 | |
| 2038 | |
| Synthetic peptides corresponding to EPB42 (erythrocyte membrane protein band 4.2) The peptide sequence was selected from the middle region of EPB42. Peptide sequence ISTKGVGSDRCEDITQNYKYPEGSLQEKEVLERVEKEKMEREKDNGIRPP. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| E42P, erythrocyte membrane protein band 4.2, Erythrocyte protein 4.2, erythrocyte surface protein band 4.2, MGC116735, MGC116737, P4.2, PA, SPH5 | |
| EPB42 | |
| IgG | |
| 80 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title