missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EPB41 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £435.00
Specifications
| Antigen | EPB41 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18205224
|
Novus Biologicals
NBP2-58715 |
100 μL |
£435.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18653448
|
Novus Biologicals
NBP2-58715-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
EPB41 Polyclonal specifically detects EPB41 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| EPB41 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 2035 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ESVPEPRPSEWDKRLSTHSPFRTLNINGQIPTGEGPPLVKTQTVTISDNANAVKSEIPTKDVPIVHTETKT | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| 4.1RBand 4.1, E41P, EL1, EPB4.1, erythrocyte membrane protein band 4.1 (elliptocytosis 1, RH-linked), erythrocyte surface protein band 4.1, HE, P4.1, protein 4.1 | |
| EPB41 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title