missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ENTHD2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-55976-25ul
This item is not returnable.
View return policy
Description
ENTHD2 Polyclonal specifically detects ENTHD2 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Specifications
| ENTHD2 | |
| Polyclonal | |
| Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL | |
| AP-4 Accessory Protein, AP-4 Complex Accessory Subunit Tepsin, C17orf56, Chromosome 17 Open Reading Frame 56, ENTH Domain Containing 2, ENTH Domain-Containing Protein 2, Epsin For AP-4, TEPSIN, TEPSIN, Adaptor Related Protein Complex 4 Accessory Protein, Tetra-Epsin | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 146705 | |
| Human | |
| IgG |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| ENTHD2 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LPILLKGTSDDDVPCPGYLFEEIAKISHESPGSSQCLLEYLLSRLHSSSGHGKLKVLKILLYLCSHGSSFFLLILKRNSAFIQEAAAFAGPPDPLHGNSLYQKVR | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction