ENT2 Antibody, Novus Biologicals™

Rabbit Monoclonal Antibody

Brand:  Novus Biologicals NBP3-33206-100ul

Product Code. 30228791

Description

ENT2 Monoclonal antibody specifically detects ENT2 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Immunohistochemistry (Paraffin),Immunocytochemistry/Immunofluorescence

Specifications

• Antigen: ENT2
• Classification: Monoclonal
• Dilution: ELISA Recommended starting concentration is 1 μg/mL, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: Delayed-early response protein 12, DER12Solute carrier family 29 member 2, ENT2, Equilibrative NBMPR-insensitive nucleoside transporter, Equilibrative nitrobenzylmercaptopurine riboside-insensitive nucleosidetransporter, equilibrative nucleoside transporter 2, HNP3636 kDa nucleolar protein HNP36, Hydrophobic nucleolar protein, 36 kDa, hydrophobic nucleolar protein, 36kD, Nucleoside transporter, ei-type, solute carrier family 29 (nucleoside transporters), member 2
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ENT2 (Q14542).,, Sequence:, MARGDAPRDSYHLVGISFFILGLGTLLPWNFFITAIPYFQARLAGAGNSTARILSTNHTGPEDAFNFNNWVTLLSQLPLLLFTLLNSFLYQCVPETVRIL
• Quantity: 100 μL
• Research Discipline: Cancer
• Gene ID (Entrez): 3177
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified