missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ENPP4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£231.00 - £444.00
Specifications
| Antigen | ENPP4 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18455880
|
Novus Biologicals
NBP1-81466-25ul |
25ul |
£231.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18060974
|
Novus Biologicals
NBP1-81466 |
0.1 mL |
£444.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ENPP4 Polyclonal specifically detects ENPP4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| ENPP4 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| EC 3.1, ectonucleotide pyrophosphatase/phosphodiesterase 4 (putative), E-NPP 4, KIAA0879ectonucleotide pyrophosphatase/phosphodiesterase 4 (putative function), NPP-4, NPP4ectonucleotide pyrophosphatase/phosphodiesterase family member 4 | |
| ENPP4 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 22875 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:DEGWTIVLNESSQKLGDHGYDNSLPSMHPFLAAHGPAFHKGYKHSTINIVDIYPMMCHILGLKPHPNNGTFGHTKCLLVDQW | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title