missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ENPP-3/CD203c Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £460.00
Specifications
| Antigen | ENPP-3/CD203c |
|---|---|
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18442751
|
Novus Biologicals
NBP1-88928-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18745423
|
Novus Biologicals
NBP1-88928 |
£460.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||||
Description
ENPP-3/CD203c Polyclonal specifically detects ENPP-3/CD203c in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| ENPP-3/CD203c | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| CD203c, CD203c antigen, dJ1005H11.3 (phosphodiesterase I/nucleotide pyrophosphatase 3), dJ914N13.3 (phosphodiesterase I/nucleotide pyrophosphatase 3), ectonucleotide pyrophosphatase/phosphodiesterase 3, ectonucleotide pyrophosphatase/phosphodiesterase family member 3, E-NPP 3, gp130RB13-6, NPP3, PD-IBETA, PDNP3B10, Phosphodiesterase I beta, Phosphodiesterase I/nucleotide pyrophosphatase 3, phosphodiesterase-I beta | |
| ENPP3 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Protein Phosphatase | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 5169 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:LHYAKNVRIDKVHLFVDQQWLAVRSKSNTNCGGGNHGYNNEFRSMEAIFLAHGPSFKEKTEVEPFEN | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title