missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ENPP-2/Autotaxin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £488.00
Specifications
| Antigen | ENPP-2/Autotaxin |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18203245
|
Novus Biologicals
NBP2-58482 |
100 μL |
£488.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18601748
|
Novus Biologicals
NBP2-58482-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ENPP-2/Autotaxin Polyclonal specifically detects ENPP-2/Autotaxin in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| ENPP-2/Autotaxin | |
| Polyclonal | |
| Rabbit | |
| Cardiovascular Biology | |
| ATXFLJ26803, ATX-X, AUTOTAXIN, autotaxin-t, EC 3.1.4.39, ectonucleotide pyrophosphatase/phosphodiesterase 2, ectonucleotide pyrophosphatase/phosphodiesterase family member 2, E-NPP 2, Extracellular lysophospholipase D, LysoPLD, PD-IALPHA, PDNP2NPP2, phosphodiesterase I/nucleotide pyrophosphatase 2, plasma lysophospholipase D | |
| ENPP2 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 5168 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TNPLREIDKIVGQLMDGLKQLKLHRCVNVIFVGDHGMEDVTCDRTEFLSNYLTNVDDITLVPGTLGRIRSKFSNNAKYDPKAIIANLT | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title