missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Enolase 1 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-33187-100ul
This item is not returnable.
View return policy
Description
Enolase 1 Monoclonal antibody specifically detects Enolase 1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| Enolase 1 | |
| Monoclonal | |
| Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL | |
| 2-phospho-D-glycerate hydro-lyase, Alpha enolase, C-myc promoter-binding protein, c-myc promoter-binding protein-1, EC 4.2.1, EC 4.2.1.11, ENO1L1, Enolase 1, enolase 1, (alpha), MBP-1, MBPB1, MPB-1, MPB1c-myc promoter-binding protein 1, MYC promoter-binding protein 1, NNE, Non-neural enolase, Phosphopyruvate hydratase, Plasminogen-binding protein, PPHalpha enolase like 1, tau-crystallin | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Enolase 1 (P06733).,, Sequence:, MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGASTGIYEALELRDNDKTRYMGKGVSKAVEHINKTIAPALVSKKLNVTEQEKIDKLMIEMDGT | |
| 100 μL | |
| Cancer, Core ESC Like Genes, Stem Cell Markers | |
| 2023 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction