missing translation for 'onlineSavingsMsg'
Learn More

ENO3 Antibody (5D1), Novus Biologicals™

Product Code. 18384558 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18384558 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18384558 Supplier Novus Biologicals Supplier No. H00002027M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

ENO3 Monoclonal antibody specifically detects ENO3 in Human, Rat, Bovine samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin), Dot Blot, KnockDown
TRUSTED_SUSTAINABILITY

Specifications

Antigen ENO3
Applications Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry, Immunoprecipitation, Immunohistochemistry (Paraffin), Dot Blot, KnockDown
Classification Monoclonal
Clone 5D1
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin, Dot Blot, Knockdown Validated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_001967
Gene Alias 2-phospho-D-glycerate hydrolyase, 2-phospho-D-glycerate hydro-lyase, beta-enolase, EC 4.2.1, EC 4.2.1.11, Enolase 3, enolase 3 (beta, muscle), enolase 3, (beta, muscle), GSD13, MSE, Muscle-specific enolase, Skeletal muscle enolase
Host Species Mouse
Immunogen ENO3 (NP_001967, 228 a.a. ~ 277 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLG
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline metabolism
Primary or Secondary Primary
Gene ID (Entrez) 2027
Target Species Human, Rat, Bovine
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.