missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ENKD1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ENKD1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ENKD1 Polyclonal specifically detects ENKD1 in Human samples. It is validated for Western Blot.Specifications
| ENKD1 | |
| Polyclonal | |
| Rabbit | |
| Q9H0I2 | |
| 84080 | |
| Synthetic peptides corresponding to ENKD1 The peptide sequence was selected from the middle region of ENKD1. Peptide sequence RHSCSLQVLAQVLEQQRQAQEHYNATQKGHVPHYLLERRDLWRREAEARK. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C16orf48, chromosome 16 open reading frame 48, DAKV6410, DKFZp434A1319, hypothetical protein LOC84080 | |
| ENKD1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title