missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
engrailed homeobox 2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£145.00 - £417.00
Tekniske data
| Antigen | engrailed homeobox 2 |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, ELISA |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Produktkode | Brand | Quantity | Pris | Antal & tilgængelighed | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktkode | Brand | Quantity | Pris | Antal & tilgængelighed | |||||
|
30232102
|
Novus Biologicals
NBP3-35750-100ul |
100 μL |
£417.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30230023
|
Novus Biologicals
NBP3-35750-20ul |
20 μL |
£145.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Beskrivelse
engrailed homeobox 2 Polyclonal antibody specifically detects engrailed homeobox 2 in Human,Mouse,Rat samples. It is validated for ELISA,Western BlotTekniske data
| engrailed homeobox 2 | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human, Mouse, Rat | |
| AUTS10, engrailed homeobox 2, engrailed homolog 2, engrailed-2, Homeobox protein en-2, homeobox protein engrailed-2, hu-En-2 | |
| A synthetic peptide corresponding to a sequence within amino acids 250-333 of human engrailed homeobox 2 (NP_001418.2).,, Sequence:, AFTAEQLQRLKAEFQTNRYLTEQRRQSLAQELSLNESQIKIWFQNKRAKIKKATGNKNTLAVHLMAQGLYNHSTTAKEGKSDSE | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500 - 1:2000, ELISA | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol | |
| 2020 | |
| IgG | |
| Affinity purified |
Ser du en mulighed for forbedring?Del en indholdskorrektion
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel