missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Endorepellin/Perlecan/Heparan Sulfate Proteoglycan Rabbit anti-Human, Polyclonal, Novus Biologicals™
Shop All Bio Techne ProductsDescription
Endorepellin/Perlecan/Heparan Sulfate Proteoglycan Polyclonal antibody specifically detects Endorepellin/Perlecan/Heparan Sulfate Proteoglycan in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | Endorepellin/Perlecan/Heparan Sulfate Proteoglycan |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | basement membrane-specific heparan sulfate proteoglycan core protein, endorepellin (domain V region), heparan sulfate proteoglycan 2, HSPG, perlecan, perlecan proteoglycan, PLCSchwartz-Jampel syndrome 1 (chondrodystrophic myotonia), PRCAN, SJA, SJS, SJS1 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RGMVFGIPDGVLELVPQRGPCPDGHFYLEHSAACLPCFCFGITSVCQSTRRFRDQIRLRFDQPDDFKGVNVTMPAQPGTPPLSSTQLQIDPSL |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?